NetMHC url error

[SDSdustyF]

Hi,

I get the following error:

2024-10-29 21:04:25,392 - mhctools.iedb:240 - INFO - Calling IEDB (http://tools-cluster-interface.iedb.org/tools_api/mhci/) with request {'method': 'netmhcpan', 'sequence_text': 'KNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGP', 'allele': 'HLA-A30:01,HLA-A30:01,HLA-A30:01,HLA-A30:01', 'length': '8,9,10,11'}
2024-10-29 21:06:36,633 - vaxrank.epitope_prediction:187 - ERROR - MHC prediction errored for protein fragment MutantProteinFragment(variant=Variant(contig='2', start=209113112, ref='C', alt='T', reference_name='GRCh37'),

I tried the url referred to in the error message (http://tools-cluster-interface.iedb.org/tools_api/mhci/) from a browser. I get "This site can’t be reached". Have tried multiple times in the past few weeks.

Is the correct url now?: http://tools.immuneepitope.org/mhci/

If so, will this be changed in an updated version of the neoantigen vaccine pipeline?

Thank you,
Sean