ESM fold prediction service is broken #627
Replies: 12 comments 7 replies
-
Thanks for flagging this. Your analysis around certificate issue could be pointing in the right direction as we got that certificate about a year ago when we were still at Meta. |
Beta Was this translation helpful? Give feedback.
-
Hi, thanks for spotting this. We'll be renewing the certificate this week. |
Beta Was this translation helpful? Give feedback.
-
Beta Was this translation helpful? Give feedback.
-
I'd also appreciate an update. We are releasing a new version of our ChimeraX molecular visualization software and need to decide if I remove ESMFold prediction. |
Beta Was this translation helpful? Give feedback.
-
It looks like everyting works again from my side. Do people still see issues? What kind of error message do you get from the API? |
Beta Was this translation helpful? Give feedback.
-
I also get the SSL certificate verification failure on an Ubuntu 22.04 LTS system, but not on a macOS 13.5.2 system. Here is the error from Ubuntu 22.04:
I'm not too knowledgable about SSL certificates but each computer has a list of root certificates usually provided by the operating system. And that is very likely the source of the problem, that Ubuntu does not have a needed certificate. Also ChimeraX calling ESMFold on Mac also fails because it uses the SSL root certificates provided by the Python certifi module which does not allow api.esmatlas.com to be verified. So the problem is wide-spread and has to be fixed by Meta properly setting up the SSL certificate for api.esmatlas.com. DigitCert's SSL checker (https://www.digicert.com/help/) continues to say api.esmatlas.com is not sending the required intermediate certificate, pasted below. And DigiCert is the issuer of the esmatlas.com certificate so that is very likely the problem. It should be easy for Meta IT person to fix this routine SSL certificate setup issue. |
Beta Was this translation helpful? Give feedback.
-
Here's another screen snapshot showing the DigiCert SSL certificate problem for api.esmatlas.com. My snapshot in the previous image obscured some of the web page. |
Beta Was this translation helpful? Give feedback.
-
Any solutions yet? |
Beta Was this translation helpful? Give feedback.
-
Using PopOS (ubuntu) this does not seem te be resolved yet? |
Beta Was this translation helpful? Give feedback.
-
Hi all, For those using Regards, |
Beta Was this translation helpful? Give feedback.
-
The ESM fold prediction web page is broken. I'd like to know if the fold prediction service is no longer maintained. I added ESM fold prediction to the widely used ChimeraX molecular visualization program and am wondering if I need to remove it from our software.
Thanks!
Here are details. The broken fold prediction web page is
Pasting any sequence such as
GENGEIPLEIRATTGAEVDTRAVTAVEMTEGTLGIFRLPEEDYTALENFRYNRVAGENWKPASTVIYVGGTYARLCAYAPYNSVEFKNSSLKTEAGLTMQTYAAEKDMRFAVSGGDEVWKKTPTAN
and pressing the enter key gives the message
Similarly the ESM folding web service as described here https://esmatlas.com/about#api
is broken. For instance
$ curl -X POST --data "GENGEIPLEIRATTGAEVDTRAVTAVEMTEGTLGIFRLPEEDYTALENFRYNRVAGENWKPASTVIYVGGTYARLCAYAPYNSVEFKNSSLKTEAGLTMQTYAAEKDMRFAVSGGDEVWKKTPTAN" https://api.esmatlas.com/foldSequence/v1/pdb/
gives error
These errors may be due to an SSL certificate error on the Meta server. An ESM prediction can be run from the ChimeraX molecular visualization program (menu Tools / Structure Prediction / ESMFold) and the error message is
Checking the certificate for api.esmatlas.com issued by DigiCert using https://www.digicert.com/help/ reports
"The server is not sending the required intermediate certificate.
This server needs to be configured to include DigiCert's intermediate certificate to avoid trust errors in web browsers."
Beta Was this translation helpful? Give feedback.
All reactions